General Information

  • ID:  hor004613
  • Uniprot ID:  Q7ZXZ6(59-120)
  • Protein name:  Augurin
  • Gene name:  ecrg4
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  Augurin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region; GO:0005737 cytoplasm; GO:0005886 plasma membrane; GO:0016020 membrane; GO:0016324 apical plasma membrane

Sequence Information

  • Sequence:  QLWDRTRPEVQQWYQQFLYMGFDEAKYEDDMSYWKNQGRGGSEYYGGFHQHHYDEDAAIGPR
  • Length:  62(59-120)
  • Propeptide:  MVVLLFLLVILLCPDSTNGNKLRKMLQKREAVEPSKPIVSVKESKANEFLNSLKRPKRQLWDRTRPEVQQWYQQFLYMGFDEAKYEDDMSYWKNQGRGGSEYYGGFHQHHYDEDAAIGPRNPYTYRHGAGVNYDDY
  • Signal peptide:  MVVLLFLLVILLCPDSTNG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May attenuate cell proliferation and induce senescence in the central nervous system.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7ZXZ6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004613_AF2.pdbhor004613_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 867139 Formula: C341H469N93O103S2
Absent amino acids: C Common amino acids: GQYD
pI: 4.66 Basic residues: 9
Polar residues: 18 Hydrophobic residues: 13
Hydrophobicity: -142.1 Boman Index: -17546
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 28.39
Instability Index: 5765 Extinction Coefficient cystines: 26930
Absorbance 280nm: 441.48

Literature

  • PubMed ID:  NA
  • Title:  NA